Colossoma macropomum (tambaqui): 118817618 Help Entry 118817618         CDS       T09004                                  Symbol calml4a Name (RefSeq) calmodulin-like protein 4a   KO K02183   calmodulin Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04020   Calcium signaling pathway cmao04070   Phosphatidylinositol signaling system cmao04114   Oocyte meiosis cmao04218   Cellular senescence cmao04261   Adrenergic signaling in cardiomyocytes cmao04270   Vascular smooth muscle contraction cmao04371   Apelin signaling pathway cmao04625   C-type lectin receptor signaling pathway cmao04744   Phototransduction cmao04910   Insulin signaling pathway cmao04912   GnRH signaling pathway cmao04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     118817618 (calml4a)    04020 Calcium signaling pathway     118817618 (calml4a)    04070 Phosphatidylinositol signaling system     118817618 (calml4a)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118817618 (calml4a)    04218 Cellular senescence     118817618 (calml4a)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118817618 (calml4a)   09152 Endocrine system    04910 Insulin signaling pathway     118817618 (calml4a)    04912 GnRH signaling pathway     118817618 (calml4a)    04916 Melanogenesis     118817618 (calml4a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118817618 (calml4a)    04270 Vascular smooth muscle contraction     118817618 (calml4a)   09157 Sensory system    04744 Phototransduction     118817618 (calml4a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmao01009]     118817618 (calml4a)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118817618 (calml4a)    03036 Chromosome and associated proteins [BR:cmao03036]     118817618 (calml4a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118817618 (calml4a) Protein phosphatases and associated proteins [BR:cmao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118817618 (calml4a) Membrane trafficking [BR:cmao04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118817618 (calml4a) Chromosome and associated proteins [BR:cmao03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118817618 (calml4a) Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118817618 (calml4a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_8 AIF-1 EF-hand_5 EH FlgD MTIP_N GPHH EF-hand_11 Motif Other DBs NCBI-GeneID:  118817618 NCBI-ProteinID:  XP_036440341 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MAKFLSQTQINEFKECFSLYDKKRKGKIEAKDLIMVMRSLGTCPTYSEVDRHLQVHKIDK TGELDFSTFLTMMHRQMQQEDPKTEILEAMRMTDKQKKGYILASELRAKLTGLGEKLTDK EVDELFKEANVGPDGLIHYEEFTKMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgaagtttctgtcccagactcaaattaatgaatttaaagaatgtttctccttgtat gataagaagcggaaggggaagattgaagctaaagacctgattatggtcatgcgctcttta ggcacctgtcccacctacagtgaggtggatcgacacttgcaagtccataagatagataaa accggtgagttggacttttccacctttctgacaatgatgcacaggcagatgcagcaggaa gaccccaagacagagatcctggaggccatgcgcatgacggacaagcagaagaagggctac atcctggcttcagagctacgagcaaaactcacaggcctgggagagaaactcactgataaa gaagtggatgagttgtttaaggaggctaatgttggccctgatggcctcattcactatgag gagttcaccaaaatggtcaccctacctcctgtggactactga

DBGET integrated database retrieval system