Colossoma macropomum (tambaqui): 118817952 Help Entry 118817952         CDS       T09004                                  Name (RefSeq) metallothionein-like   KO K14739   metallothionein 1/2 Organism cmao  Colossoma macropomum (tambaqui) Brite KEGG Orthology (KO) [BR:cmao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmao03019]     118817952    03029 Mitochondrial biogenesis [BR:cmao03029]     118817952 Messenger RNA biogenesis [BR:cmao03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118817952 Mitochondrial biogenesis [BR:cmao03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     118817952 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  118817952 NCBI-ProteinID:  XP_036440882 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDPCDCAKTGSCSCGSSCKCTNCQCTSCKKSCCSCCPSTCSKCASGCVCKGKSCDSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgtgactgcgccaagactggaagctgcagctgtggttcaagctgcaaatgc acaaactgccagtgtacatcctgcaagaaaagctgctgctcctgctgtccatctacctgc agcaagtgtgcctctggatgtgtgtgcaagggcaaatcctgtgactccagctgctgtcag tga

DBGET integrated database retrieval system