Colossoma macropomum (tambaqui): 118822088 Help Entry 118822088         CDS       T09004                                  Symbol cdc42l2 Name (RefSeq) cell division cycle 42 like 2   KO K04393   cell division control protein 42 Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04010   MAPK signaling pathway cmao04144   Endocytosis cmao04370   VEGF signaling pathway cmao04510   Focal adhesion cmao04520   Adherens junction cmao04530   Tight junction cmao04810   Regulation of actin cytoskeleton cmao04912   GnRH signaling pathway cmao05100   Bacterial invasion of epithelial cells cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118822088 (cdc42l2)    04370 VEGF signaling pathway     118822088 (cdc42l2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118822088 (cdc42l2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118822088 (cdc42l2)    04520 Adherens junction     118822088 (cdc42l2)    04530 Tight junction     118822088 (cdc42l2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118822088 (cdc42l2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     118822088 (cdc42l2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118822088 (cdc42l2)    05100 Bacterial invasion of epithelial cells     118822088 (cdc42l2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118822088 (cdc42l2)    03036 Chromosome and associated proteins [BR:cmao03036]     118822088 (cdc42l2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118822088 (cdc42l2)    04031 GTP-binding proteins [BR:cmao04031]     118822088 (cdc42l2) Membrane trafficking [BR:cmao04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118822088 (cdc42l2)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     118822088 (cdc42l2)   Macropinocytosis    Ras GTPases     118822088 (cdc42l2) Chromosome and associated proteins [BR:cmao03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     118822088 (cdc42l2) Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of microglial cells    118822088 (cdc42l2)   Exosomal proteins of breast milk    118822088 (cdc42l2) GTP-binding proteins [BR:cmao04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118822088 (cdc42l2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  118822088 NCBI-ProteinID:  XP_036446818 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTTEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaaatgtgtagtagttggagatggtgctgtgggtaaaacttgccttttg atttcatacaccacaaacaagttcccttcagagtacgtaccaacagtgtttgataactat gccgtaactgtaatgatcggcggtgaaccttacactcttggattatttgacactgcaggt caggaagattatgatcggttgcgtcccctgagctatccccaaaccgacgtcttcctagtt tgtttctctgtagtttcaccctcttcctttgaaaacgtcaaagaaaaatgggtccctgag attacccatcactgtccaaagaccccattcctattggtcggaacgcagattgaccttaga gacgatccctcaactactgaaaagcttgccaagaacaagcagaagcccatcactcccgaa acggcagagaaactagccagggacctgaaagcggtgaaatatgtggaatgttcggcttta acacagaaagggctgaagaatgtatttgatgaggccatcctagctgccctggagcccccg gagcctaagaagaagcgtaaatgtgttcttttatga

DBGET integrated database retrieval system