Colossoma macropomum (tambaqui): 118824635 Help Entry 118824635         CDS       T09004                                  Symbol ccl27b Name (RefSeq) C-C motif chemokine 27b   KO K05513   C-C motif chemokine 28 Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04060   Cytokine-cytokine receptor interaction cmao04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118824635 (ccl27b)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118824635 (ccl27b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmao04052]     118824635 (ccl27b) Cytokines and neuropeptides [BR:cmao04052]  Cytokines   Chemokines    118824635 (ccl27b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Coleoptericin Motif Other DBs NCBI-GeneID:  118824635 NCBI-ProteinID:  XP_036450818 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MDLKVLLLVLCIAFTSVQGAIPTCCVQTSRIPLSILQEVEKFDVQNRNGACEIDAVVLHH KGKKYCALPRAKTVLQIIHKKKMGSKYMV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatctcaaagtgcttctgctggtcctgtgcatcgccttcacctccgtccaaggtgcc attccaacatgctgcgttcaaacctcccgcatccctctatccatactgcaggaggtggag aagtttgatgtccaaaatcggaatggagcctgtgagatcgatgccgtggtgttgcatcat aagggaaagaagtactgtgccttgcccagagcaaagaccgtactgcaaatcatacataag aaaaagatggggagcaaatatatggtttaa

DBGET integrated database retrieval system