KEGG   Celeribacter marinus: IMCC12053_2669
Entry
IMCC12053_2669    CDS       T04098                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cmar  Celeribacter marinus
Pathway
cmar00260  Glycine, serine and threonine metabolism
cmar00750  Vitamin B6 metabolism
cmar01100  Metabolic pathways
cmar01110  Biosynthesis of secondary metabolites
cmar01120  Microbial metabolism in diverse environments
cmar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IMCC12053_2669
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    IMCC12053_2669
Enzymes [BR:cmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     IMCC12053_2669
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: ALI56616
UniProt: A0A0N9ZS01
LinkDB
Position
complement(2601772..2603154)
AA seq 460 aa
MKYISTRGHAPDLSFEEAMLTGLASDGGLYVPETIPTLSMDEIASFAGQSYEDVAFRVMK
PFIGETFTDAEFKEIIAKAYATFSHDARAPLVQLGPNHFLLELFHGPTLAFKDFAMQLIG
QLFQAALERRGDRVTIVGATSGDTGSAAIEAFKGLHNVDVFILFPHGRVSDVQRRQMTTP
TEANVHALAVEGDFDDCQAALKEMFADHEFRDGVKLAAVNSINWARVLAQVVYYFTSAVS
LGAPHRKVSFTVPTGNFGDIFAGYIAKKMGLPIEELVIATNHNDILHRTMETGACTKQGV
TPSISPSMDIQVSSNFERALFDVYDREGAAIAQLMDEFKAGEFKISQGAMDRLRDLFASG
RASEDETSQAIAAFHARTTEVLCPHTAVAVKVAEAHLSDVPMISLATAHPAKFPAAVEAA
CGIHPELPERMGDLFGKDERFTVVPNDLATLKALVKERLA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaatatatctccacacgcggccatgcgccggacctttcatttgaagaagcgatgctg
acagggcttgcgtccgatggtgggctttatgtgcccgaaaccatcccgaccctgtcgatg
gatgagatcgcatcctttgccggccagtcgtacgaagacgttgcatttcgcgtcatgaaa
ccgttcatcggcgagacgtttaccgacgccgagtttaaagagatcattgcgaaagcctac
gccacatttagccatgatgcgcgcgcaccgttggtgcaactcggtccgaaccatttcttg
ttggaattgttccacggccccactttggcattcaaagattttgcgatgcaactcattggt
cagttgtttcaagcggcccttgaacgccgcggcgaccgcgtgacgattgtgggcgcaacc
tctggcgataccggatcagcggcaattgaggcattcaaagggttgcacaatgtcgatgtg
tttatcctctttccgcatggccgcgtttccgatgtgcagcgccgtcagatgacaacgccc
acagaggcgaacgtgcatgcgcttgccgttgagggcgattttgacgattgtcaggcagcc
ctcaaagagatgtttgcagatcatgagttccgtgacggtgtgaaactggccgccgtaaat
tcgatcaactgggcgcgggttttggcccaagttgtttactactttacctcggctgtgtcg
cttggtgcgccacatcgcaaggtgtcgttcacggtgcccacgggcaactttggtgacatt
ttcgcgggctatattgccaaaaaaatgggcctgccgattgaagaattggtaatcgctacc
aaccataacgacattttgcaccgcacgatggaaacgggagcctgcaccaagcaaggtgtg
acaccgtcgatatctccgtcgatggatattcaggtcagctccaactttgagcgggccttg
ttcgacgtttacgaccgtgagggcgcagcaattgcgcagcttatggacgagtttaaagcc
ggagagttcaagatttcccaaggggcgatggaccgtttgcgcgatttgttcgcgtccggc
cgcgcgtccgaggacgaaacatctcaagcgatcgcggcattccacgcacgcacgaccgaa
gtgctatgcccccatacggccgtggcggtaaaagtggccgaggcgcatctgtcggacgtc
ccgatgatttcactggcgactgcacaccccgcaaaatttcccgccgccgtggaggccgca
tgcggcatccatcccgagttgcccgaacgtatgggtgacctgttcggcaaagacgaacgg
tttaccgttgtccccaatgatttagccacgctcaaagcgttggtgaaggagcgtctcgct
tga

DBGET integrated database retrieval system