KEGG   Chitinibacter mangrovi: ABHF33_05255
Entry
ABHF33_05255      CDS       T11125                                 
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
  KO
K07091  lipopolysaccharide export system permease protein
Organism
cmav  Chitinibacter mangrovi
Pathway
cmav02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cmav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABHF33_05255 (lptF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmav02000]
    ABHF33_05255 (lptF)
Transporters [BR:cmav02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    ABHF33_05255 (lptF)
SSDB
Motif
Pfam: LptF_LptG COBRA1
Other DBs
NCBI-ProteinID: XBM02331
UniProt: A0AAU7FDQ3
LinkDB
Position
complement(1142367..1143428)
AA seq 353 aa
MLFRKTLIHEMTWMAFGLFIVLLLIVMTSQVVRLLGEAALGALASSAVWAVMGFTAVRYL
PLLFSLMLFITILSVITRLWKDHEMFVWFSAGRSIYDFIGPVLTMGLPVVLLIGALSLGV
SPWAQLKGKEYREASLSNQEVTQVAPGVFRESRGADRVYFIENFSAERGLGENVFLQIRQ
NGKISTILADQGGMEIDEQGDRWMWLKNATAYQAIPGSPQYDILTFETGKIRIDVPSKPL
VSPAIEAMKTLQLLKHLSPQAWAELHWRMALPIQALILMLAAIPLAFANPRGGRSFNLLF
AALLAFSYYNAINVLQAWIATEKIPGLIGMWPLHVLAALLTLLLYRWRSKVRA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctttttcgcaaaaccctgattcatgaaatgacctggatggcctttggcctgttcatt
gtgttattgctgatcgtcatgacctcgcaagtagtgcgcctgctcggcgaagctgcgcta
ggggcgctggccagctcggctgtctgggccgtgatgggctttaccgccgtgcgctatctg
ccgctgctgttttcgctaatgctgtttattaccattttgtcggtgattacccggctatgg
aaagatcacgaaatgtttgtctggttttcggccgggcgctcgatttatgactttattggc
ccggtactgacgatgggtctgcctgtggtattgctgattggcgcgctatcgctgggcgtg
tctccgtgggcacagctcaaaggcaaggaatatcgcgaagccagcctgagcaatcaggaa
gtcacccaggttgctcctggtgtttttcgcgagtcgcgcggcgctgaccgggtgtatttc
attgagaatttttcggctgagcgcgggctgggcgagaatgtttttttgcagattcgccag
aacggcaagatctcgaccattctggccgatcagggcgggatggagattgatgagcagggc
gaccgctggatgtggctgaaaaatgccaccgcgtatcaggccattccgggtagtccgcag
tacgatattctgacctttgaaacgggcaaaatccgcattgatgtgcccagcaaaccgctg
gtcagcccggccatcgaggccatgaaaacgctccagttgctgaaacacttaagtccgcaa
gcctgggccgagctgcattggcgcatggctttgccgattcaggcgctgattctgatgctg
gctgccatcccgctggcctttgccaacccgcgcggtgggcgctctttcaacctgctgttt
gccgctttgctggctttctcttattacaacgcgattaacgtgctgcaagcatggattgcc
accgaaaaaattcccggtttgatcggcatgtggccgctgcatgtgttggcggcgctgttg
acgctgctgctttaccgctggcgcagcaaggtgagggcttaa

DBGET integrated database retrieval system