Cucurbita maxima (winter squash): 111466118 Help Entry 111466118         CDS       T05246                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cmax  Cucurbita maxima (winter squash) Pathway cmax04016   MAPK signaling pathway - plant cmax04070   Phosphatidylinositol signaling system cmax04075   Plant hormone signal transduction cmax04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cmax00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     111466118    04070 Phosphatidylinositol signaling system     111466118    04075 Plant hormone signal transduction     111466118  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     111466118  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmax01009]     111466118   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmax04131]     111466118    03036 Chromosome and associated proteins [BR:cmax03036]     111466118   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmax04147]     111466118 Protein phosphatases and associated proteins [BR:cmax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111466118 Membrane trafficking [BR:cmax04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111466118 Chromosome and associated proteins [BR:cmax03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111466118 Exosome [BR:cmax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111466118 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 EF-hand_11 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C PA_Ig-like Fe_hyd_lg_C PhageMin_Tail SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  111466118 NCBI-ProteinID:  XP_022966473 UniProt:  A0A6J1HS95 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcaacttaccgacgatcagatctctgagttcaaggaggccttcagcttattc gacaaggatggcgacggttgtataacaaccaaggagcttggtactgttatgaggtcacta ggtcagaatccaaccgaagcggagcttcaggacatgattaatgaggtcgatgctgatggc aatggaacaatcgactttcccgaattcctaaacctcatggctaggaagatgaaggatacg gattctgaggaggagttgaaagaggcattccgagtcttcgataaggaccagaatggcttc atctccgctgctgagctccgccatgtgatgaccaatctcggcgagaaactgaccgaggag gaggtcgatgagatgatcagagaagccgatgtggatggcgatggccagattaactacgac gaattcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system