Cucurbita maxima (winter squash): 111466963 Help Entry 111466963         CDS       T05246                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax03018   RNA degradation cmax03040   Spliceosome Brite KEGG Orthology (KO) [BR:cmax00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     111466963   09123 Folding, sorting and degradation    03018 RNA degradation     111466963  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmax03019]     111466963    03041 Spliceosome [BR:cmax03041]     111466963 Messenger RNA biogenesis [BR:cmax03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      111466963   mRNA degradation factors    5'-3' decay     Lsm complex      111466963 Spliceosome [BR:cmax03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     111466963  Complex C   U2 snRNP components     111466963 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  111466963 NCBI-ProteinID:  XP_022967419 UniProt:  A0A6J1HWN2 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLSIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgtttttctcgtacttcaaggatttggtgggcagagaggtgacagtcgagttgaaa aatgacctatcaattagaggaactctgcactccgttgatcaatatctcaacatcaaactt gaaaacaccagggttgttgatcaagacaaataccctcacatgctttctgtgagaaactgt tttatcaggggatcggtggtgagatatgttcaacttccaccagatggcgttgatatcgag ctgttgcacgatgccacgagacgcgaggctcggggtggctaa

DBGET integrated database retrieval system