Cucurbita maxima (winter squash): 111468647 Help Entry 111468647         CDS       T05246                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism cmax  Cucurbita maxima (winter squash) Brite KEGG Orthology (KO) [BR:cmax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cmax03041]     111468647   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmax04052]     111468647 Spliceosome [BR:cmax03041]  Complex B   Other components    Complex B specific factors     111468647 Cytokines and neuropeptides [BR:cmax04052]  Neuropeptides   Unclassified    111468647 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  111468647 NCBI-ProteinID:  XP_022969698 UniProt:  A0A6J1I1R2 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggttctcaacgatcgtctcgggaagaaggtccgggtgaagtgcaacgag gacgacacgatcggcgacttgaagaagctcgttgccgctcagaccggaaccagggccgag aagatcaggatccagaagtggtacaatatctacaaggatcacatcaccctcaaggattac gagatccatgatggcatgggtctcgagctctattacaactga

DBGET integrated database retrieval system