Cucurbita maxima (winter squash): 111491022 Help Entry 111491022         CDS       T05246                                  Name (RefSeq) calmodulin-like protein 8   KO K02183   calmodulin Organism cmax  Cucurbita maxima (winter squash) Pathway cmax04016   MAPK signaling pathway - plant cmax04070   Phosphatidylinositol signaling system cmax04075   Plant hormone signal transduction cmax04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cmax00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     111491022    04070 Phosphatidylinositol signaling system     111491022    04075 Plant hormone signal transduction     111491022  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     111491022  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmax01009]     111491022   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmax04131]     111491022    03036 Chromosome and associated proteins [BR:cmax03036]     111491022   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmax04147]     111491022 Protein phosphatases and associated proteins [BR:cmax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111491022 Membrane trafficking [BR:cmax04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111491022 Chromosome and associated proteins [BR:cmax03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111491022 Exosome [BR:cmax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111491022 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C EF-hand_11 DUF5580_M PA_Ig-like Motif Other DBs NCBI-GeneID:  111491022 NCBI-ProteinID:  XP_022995507 UniProt:  A0A6J1JZ40 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAVEALTEDQIADFREAFCLIDKDADGFISVEELAAVIQSLDGHPTKNEVRDMICEVDVD ANGTIDFDEFLNVMARKLKGNVTEELKEAFKVFDRDQDGYISAFELRNVMINLGERLTDE EAEQMIREADLDGDGRVSYEEFANIMTIT NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgttgaagctcttactgaagatcagattgctgatttccgggaagccttctgttta attgacaaggatgcggatggattcatcagtgtggaggagctagcggcagtgattcagtca ttggatggacatcccaccaagaatgaagttagagatatgatatgcgaagtggatgtggac gctaatgggacgatagattttgatgagttcctgaatgtgatggcaaggaaattgaagggc aatgtgacggaggagctaaaagaggccttcaaagtgtttgatagggaccaagatggttat atctcagcttttgagctgagaaatgtaatgataaatttgggagagagattgacagatgag gaggctgaacaaatgattcgagaggcggatttggatggcgatggcagagtgagttatgaa gagtttgccaacattatgacaatcacttga

DBGET integrated database retrieval system