Cucurbita maxima (winter squash): 111496326 Help Entry 111496326         CDS       T05246                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax04145   Phagosome cmax04148   Efferocytosis cmax04517   IgSF CAM signaling cmax04518   Integrin signaling cmax04620   Toll-like receptor signaling pathway cmax05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmax00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     111496326    04518 Integrin signaling     111496326  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111496326    04148 Efferocytosis     111496326  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111496326  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111496326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmax04131]     111496326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmax04147]     111496326    04031 GTP-binding proteins [BR:cmax04031]     111496326 Membrane trafficking [BR:cmax04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111496326  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111496326   Macropinocytosis    Ras GTPases     111496326  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111496326 Exosome [BR:cmax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111496326   Exosomal proteins of other body fluids (saliva and urine)    111496326   Exosomal proteins of colorectal cancer cells    111496326   Exosomal proteins of bladder cancer cells    111496326 GTP-binding proteins [BR:cmax04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111496326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  111496326 NCBI-ProteinID:  XP_023002505 UniProt:  A0A6J1KP50 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELTKTIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKSKKKKKKSQSVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgttacggtgggcgatggtgctgtgggtaaaacc tgtatgttgatttcttatacgagtaacacctttcccacggactacgtgcccaccgttttt gacaatttcagtgccaatgtggtggttgatggaaacactgtcaacttaggattatgggat actgctggtcaagaggattacaatagattaagaccactgagttatcgaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgctaagaagtgg attcctgagttgagacattatgcacctggtgttccaatagttcttgttggaactaaactt gatcttcgggatgacaagcaattctttgtagaccacccgggtgcggtgccaatttctact gttcagggagaggagttgacaaaaacaattggagccccggcatacatcgaatgtagttca aaaactcagcagaatgtgaaagcagtgtttgatgcagccattaaagtggtgctccagccg cccaagtcaaagaagaagaagaagaagtcacagagtgtctgttccatcttatga

DBGET integrated database retrieval system