Cucurbita maxima (winter squash): 111496326 Help Entry 111496326         CDS       T05246                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax04145   Phagosome cmax04148   Efferocytosis cmax04620   Toll-like receptor signaling pathway cmax05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmax00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111496326    04148 Efferocytosis     111496326  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111496326  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111496326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmax04131]     111496326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmax04147]     111496326    04031 GTP-binding proteins [BR:cmax04031]     111496326 Membrane trafficking [BR:cmax04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111496326  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111496326   Macropinocytosis    Ras GTPases     111496326  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111496326 Exosome [BR:cmax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111496326   Exosomal proteins of other body fluids (saliva and urine)    111496326   Exosomal proteins of colorectal cancer cells    111496326   Exosomal proteins of bladder cancer cells    111496326 GTP-binding proteins [BR:cmax04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111496326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  111496326 NCBI-ProteinID:  XP_023002505 UniProt:  A0A6J1KP50 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELTKTIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKSKKKKKKSQSVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgttacggtgggcgatggtgctgtgggtaaaacc tgtatgttgatttcttatacgagtaacacctttcccacggactacgtgcccaccgttttt gacaatttcagtgccaatgtggtggttgatggaaacactgtcaacttaggattatgggat actgctggtcaagaggattacaatagattaagaccactgagttatcgaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgctaagaagtgg attcctgagttgagacattatgcacctggtgttccaatagttcttgttggaactaaactt gatcttcgggatgacaagcaattctttgtagaccacccgggtgcggtgccaatttctact gttcagggagaggagttgacaaaaacaattggagccccggcatacatcgaatgtagttca aaaactcagcagaatgtgaaagcagtgtttgatgcagccattaaagtggtgctccagccg cccaagtcaaagaagaagaagaagaagtcacagagtgtctgttccatcttatga

DBGET integrated database retrieval system