KEGG   Cucurbita maxima (winter squash): 111499445
Entry
111499445         CDS       T05246                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2-like
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cmax03029]
    111499445
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmax02000]
    111499445
Mitochondrial biogenesis [BR:cmax03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    111499445
Transporters [BR:cmax02000]
 Other transporters
  Primary active transporters [TC:3]
   111499445
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 111499445
NCBI-ProteinID: XP_023006791
UniProt: A0A6J1KYR6
LinkDB
Position
Unknown
AA seq 224 aa
MGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFLKGVYSSPKGARLLGGSQAVQMNAP
RIGGSFAVWGGLFSTFDCSMVYLRQKEDPWNSIIAGAATGGFLQMRQGVGASARSAVFGG
VLLALIEGAGIMLNKVLSQPQNAPIMIDDAGAMGGVPGYPMEQIPGLTPPQTLPQEAAGA
GSGSWFGGWFNGGQKKDKEATRGESETKILESFDSPPVPNFEYK
NT seq 675 nt   +upstreamnt  +downstreamnt
atgggaacgccggagacctctcgggagccttgtccagatcggatcctcgatgacatcggt
ggcgcctttggtatgggcgccgtcggtggctcggccttccactttctcaaaggcgtctac
agttctcctaaaggcgctcgcctcctcggcggttctcaagccgtccaaatgaacgctcct
cgtattggcggtagctttgccgtatggggcggcttgttctccacatttgattgctccatg
gtttacctccgccagaaggaagatccgtggaactcgatcatagccggtgccgcaactggc
ggtttcctccagatgcgtcagggcgtcggcgcctccgctcgatcggctgtgttcggcgga
gttctgttggctctgatcgagggggccgggatcatgctgaataaggttcttagtcaaccg
cagaacgctcctattatgatcgacgatgccggtgctatgggcggtgttcctggttatcct
atggaacagattccgggcctaacgccgccgcagactcttcctcaggaggctgcgggtgcg
ggctcgggatcgtggttcggaggatggttcaatggcggacagaaaaaggataaagaagca
actcgtggagagagcgaaacgaagattttggagagctttgattcgccgccggtgccgaat
ttcgaatacaagtaa

DBGET integrated database retrieval system