Cucurbita maxima (winter squash): CYL43_pgp050 Help Entry CYL43_pgp050      CDS       T05246                                  Symbol psbF Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism cmax  Cucurbita maxima (winter squash) Pathway cmax00195   Photosynthesis cmax01100   Metabolic pathways Module cmax_M00161   Photosystem II cmax_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:cmax00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     CYL43_pgp050 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cmax00194]     CYL43_pgp050 (psbF) Photosynthesis proteins [BR:cmax00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     CYL43_pgp050 (psbF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  YP_009447466 LinkDB All DBs AA seq 39 aa AA seqDB search MTIDKTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgactatcgataaaacttatcctatttttacagtgcgatggttggctgttcacggacta gctgtacctaccgtttcttttttagggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system