KEGG   Caulobacter mirabilis: CSW64_09415
Entry
CSW64_09415       CDS       T05166                                 
Name
(GenBank) acetyl/propionyl-CoA carboxylase subunit alpha
  KO
K01965  propionyl-CoA carboxylase alpha subunit [EC:6.4.1.3]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00280  Valine, leucine and isoleucine degradation
cmb00630  Glyoxylate and dicarboxylate metabolism
cmb00640  Propanoate metabolism
cmb01100  Metabolic pathways
cmb01110  Biosynthesis of secondary metabolites
cmb01120  Microbial metabolism in diverse environments
cmb01200  Carbon metabolism
Module
cmb_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CSW64_09415
   00640 Propanoate metabolism
    CSW64_09415
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSW64_09415
Enzymes [BR:cmb01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     CSW64_09415
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C PCC_BT Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK Biotin_lipoyl_2 ATPgrasp_ST ATP-grasp_5 GARS_A HlyD_D23
Other DBs
NCBI-ProteinID: ATQ42609
UniProt: A0A2D2AX72
LinkDB
Position
complement(1922586..1924562)
AA seq 658 aa
MFSKILIANRGEIAVRVIKTCRRLGIKTVVVYSEADADSLAVEMADESVFIGPAPAAQSY
LVADKIIEACKQTGAQAVHPGFGFLSENAGFAQRCADEGVVFIGPNPGAIQAMGDKIESK
KFAEKAGVSCVPGHIGEIDDTAHAVRISEEIGYPVMIKASAGGGGKGIRVAHNRQDVEEG
FPAVRAEAKASFGDDRIFIEKFITSPRHIEIQVLGDKHGHVVHLFERECSIQRRNQKVIE
EAPSPLLDEKTRAEMGAQAVALAQAVGYDSAGTVEFVAGQDKSFYFLEMNTRLQVEHPVT
ELITGLDLVEQMIRSAYGEPLAFKQDDLKINGWAIESRIYAEDPYRKFLPSIGRLVRYDP
PAEGERETYRVRNDAGVREGDEISMYYDPMISKLCTWAPTRIEAIDGMARALEDFYIEGL
GQNVPFLAAVMDQERFRSGALATSYIADEFPEGFAGTAPTALQTDIMTAAGVAMHRLLAA
RAGGAPRREWTVLVGHDSRVVAVDETDGVLSLYLAGEDRTLTLDDVVWLPGRPQFKGALN
GVPFTVDVAPAAEGFVIRHRAAKRKVLVLTARSAELHGKLPEKAAADTSKMIISPMPGLI
VSMDVEVGQTVREGEIVCVIEAMKMQNIIRAEKEAVVKTVSAKAGDSVAADEVLVEFA
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgttctcgaaaattctgatcgccaaccggggtgaaatcgcggtgcgggtcatcaagacc
tgccgccggctggggatcaagacggtggtggtctactccgaggccgacgccgacagtctg
gccgtcgagatggccgacgagtcggtgttcatcggccccgcccccgcggcccagtcctac
ctggtcgccgacaagatcatcgaggcctgcaaacagaccggcgcccaggcggtgcacccg
ggtttcggcttcctgtccgagaacgccggcttcgcccagcgctgcgccgacgagggcgtc
gtcttcatcgggccgaacccgggcgccatccaggccatgggcgacaagatcgagtccaag
aagttcgccgagaaggccggcgtgagctgcgtccccggtcatatcggcgagatcgacgac
accgcccacgccgtccgcatctccgaggagatcggctatccggtgatgatcaaggcgtcg
gccggcggcggcggcaagggcatccgcgtcgcccacaatcgtcaggacgtcgaggaaggc
ttcccggccgtccgcgccgaggccaaggccagcttcggcgacgatcggatcttcatcgag
aagttcatcaccagcccgcgccacatcgagatccaggtgctgggcgacaagcacggccac
gtcgtgcacctgttcgagcgcgaatgctcgatccagcgccggaaccagaaggtcatcgag
gaagcgccgtccccgctgctcgacgagaagacccgcgccgagatgggcgcccaggccgtc
gccctggcccaggccgtcggctacgacagcgccggcaccgtcgagttcgtcgccggccag
gacaagagcttctacttcctggagatgaacacccgcctgcaggtcgagcatccggtcacc
gagctgatcaccggtctggacctggtcgagcagatgatccgttcggcctacggcgagccg
ctcgcgttcaagcaggacgacctgaagatcaacggctgggccatcgagagccggatctac
gccgaggatccctaccgcaagttcctgccgtcgatcggccgcctggtcaggtacgacccg
cccgccgaaggcgagcgggagacctacagggtccgcaacgacgccggcgtccgcgagggc
gacgagatctcgatgtactacgacccgatgatctccaagctctgcacctgggcgccgacc
cggatcgaggcgatcgacggcatggcccgcgcgctggaggacttctacatcgagggcctg
ggccagaacgtgccattcctggccgcggtcatggaccaggagcgcttccgctccggcgcg
ctggccaccagctacatcgccgacgagttccccgagggcttcgccgggacggcgccgacc
gccctgcagaccgacatcatgaccgccgcgggcgtggccatgcaccgcctgctcgccgcc
cgcgccggcggcgccccgcgccgcgaatggacggtgctggtgggccatgacagccgcgtg
gtcgcggtcgacgagaccgacggcgtgctgagcctctacctcgcgggcgaagaccgcacc
ctgacgctggacgacgtggtctggctgccgggccggccgcagttcaagggcgcgctgaac
ggcgttcccttcaccgtcgacgtggccccggccgccgagggcttcgtgatccgccaccgc
gccgccaagcgcaaggtgctggtcctgaccgcccgctcggccgagctgcacggcaagctg
cccgagaaggcggcggccgacacctcgaagatgatcatctcgccgatgccgggcctgatc
gtctcgatggacgtcgaagtcggccagacggtgcgcgagggcgagatcgtctgcgtcatc
gaggcgatgaagatgcagaacatcatccgcgccgagaaggaggccgtcgtgaagaccgtc
tcggccaaggccggcgacagcgtcgccgccgacgaggtgctggtcgagttcgcctag

DBGET integrated database retrieval system