Cyanidioschyzon merolae: CYME_CMK219C Help Entry CYME_CMK219C      CDS       T00175                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cme  Cyanidioschyzon merolae Pathway cme04016   MAPK signaling pathway - plant cme04070   Phosphatidylinositol signaling system cme04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:cme00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     CYME_CMK219C    04070 Phosphatidylinositol signaling system     CYME_CMK219C    04075 Plant hormone signal transduction     CYME_CMK219C  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cme01009]     CYME_CMK219C   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cme04131]     CYME_CMK219C    03036 Chromosome and associated proteins [BR:cme03036]     CYME_CMK219C   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cme04147]     CYME_CMK219C Protein phosphatases and associated proteins [BR:cme01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      CYME_CMK219C Membrane trafficking [BR:cme04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     CYME_CMK219C Chromosome and associated proteins [BR:cme03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      CYME_CMK219C Exosome [BR:cme04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    CYME_CMK219C BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF-hand_11 SPARC_Ca_bdg EF-hand_STIM1 PA_Ig-like TerB Dockerin_1 RTX_C DUF6582 EF-hand_EFHB_C DUF5580_M RNA_pol_Rpb4 Mesothelin SPEF2_C Imm5_like Phage_tail_S FCaBP_EF-hand Motif Other DBs NCBI-GeneID:  16994343 NCBI-ProteinID:  XP_005536612 UniProt:  M1USC1 LinkDB All DBs Position 11:599220..599570 Genome browser AA seq 116 aa AA seqDB search MRSLGQNPTEAHLREMIAEVDQDGSGTIDFDEFLALMASKMKDIDTEQEVREAFAVFDKN NDGKISADELRAVMLKLGERLTDEEIDEMIREADADGDGYIDYQEFSNLLQWDQHT NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcgctcgttaggccagaaccctacggaagcccacttacgcgagatgatcgccgaggtt gatcaagacggatcaggcactatcgattttgatgaattccttgcgctgatggcaagcaag atgaaagacatcgataccgagcaggaagtgcgggaggcatttgcggttttcgataagaac aatgacggcaaaatcagcgctgatgagttacgggcggtcatgctgaagctgggtgagcga ctcacagacgaagagatcgatgaaatgattcgcgaagcggatgccgatggagacggctat attgactaccaggaattttcgaacttattgcaatgggatcagcacacctaa

DBGET integrated database retrieval system