Chenggangzhangella methanolivorans: K6K41_00535 Help Entry K6K41_00535       CDS       T07462                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cmet  Chenggangzhangella methanolivorans Pathway cmet02024   Quorum sensing cmet03018   RNA degradation Brite KEGG Orthology (KO) [BR:cmet00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     K6K41_00535 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     K6K41_00535 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmet03019]     K6K41_00535 (hfq)    03036 Chromosome and associated proteins [BR:cmet03036]     K6K41_00535 (hfq) Messenger RNA biogenesis [BR:cmet03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      K6K41_00535 (hfq) Chromosome and associated proteins [BR:cmet03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     K6K41_00535 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  QZO00321 UniProt:  A0A9E6RFH8 LinkDB All DBs Position complement(117059..117331) Genome browser AA seq 90 aa AA seqDB search MAAERAQNLQDTFLNNVRKNKVPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKH AISTVMPGHPIQLFEPEEAEGDIVPSRGGR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccgctgagcgcgcacagaaccttcaagacacctttctcaacaatgtccgcaagaac aaggtcccgctgacgatcttcctggtgaacggcgtcaagctgcagggcgtggtcacctgg ttcgacaatttctgcgtgttgctgcgccgcgacgggcactcgcaactcgtgtacaagcac gccatatcgacggtgatgccgggacacccgatccagctcttcgagcccgaagaggcggaa ggggacatcgtcccgtcgcgcggcgggcggtga

DBGET integrated database retrieval system