Chenggangzhangella methanolivorans: K6K41_23965 Help Entry K6K41_23965       CDS       T07462                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmet  Chenggangzhangella methanolivorans Pathway cmet01100   Metabolic pathways cmet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K6K41_23965    00074 Mycolic acid biosynthesis     K6K41_23965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K6K41_23965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QZN99698 UniProt:  A0A9E6R7Z2 LinkDB All DBs Position 4804551..4804793 Genome browser AA seq 80 aa AA seqDB search MSDIAERVKKIVVEHLGVDAEKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAAQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgacattgccgaacgggtgaagaagatcgtggtcgagcacctcggcgtcgacgcc gagaaggtcaccgaaaacgcgagcttcatcgacgatctcggcgccgacagcctcgacacc gtcgagctcgtgatggcgttcgaggaagagttcggctgcgagatcccggacgacgccgcc gagaccattctgacggtcggcgacgccaccaagtttctcgagaagaacgccgcccaggcc tga

DBGET integrated database retrieval system