Caldinitratiruptor microaerophilus: caldi_03430 Help Entry caldi_03430       CDS       T08566                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism cmic  Caldinitratiruptor microaerophilus Pathway cmic03060   Protein export cmic03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cmic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     caldi_03430  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     caldi_03430  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cmic02044]     caldi_03430 Secretion system [BR:cmic02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    caldi_03430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BDG59253 UniProt:  A0AA35G7F0 LinkDB All DBs Position 352564..352785 Genome browser AA seq 73 aa AA seqDB search MFRNLGPMEIGLILLILLLLFGGSKLPELARGLGKGIREFKQSMRDEGPAEEKPPAGGAP EKTAAEGSARKEG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgttccgcaacctggggccgatggagatcgggctcatcctgctgatcctcctgctgctc ttcggggggtccaagctcccggagcttgcccgcggtctgggcaaggggatccgggagttc aagcaatccatgcgggacgaggggccggcggaggagaagccaccggccggcggcgctccg gagaagaccgcggcggagggttccgcgcgcaaggaaggctag

DBGET integrated database retrieval system