Caldinitratiruptor microaerophilus: caldi_17010 Help Entry caldi_17010       CDS       T08566                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmic  Caldinitratiruptor microaerophilus Pathway cmic01100   Metabolic pathways cmic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     caldi_17010 (acpP)    00074 Mycolic acid biosynthesis     caldi_17010 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     caldi_17010 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BDG60611 UniProt:  A0AA35CNI0 LinkDB All DBs Position complement(1712331..1712573) Genome browser AA seq 80 aa AA seqDB search MASKDDIFKKVKAIIVDQLGVEESEVTPEAHFIDDLGADSLDIVELIMALEEEFGLEIPD EEAEKIATVNDAVEYIRSNS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccagcaaggacgatattttcaagaaagtaaaggcaatcatcgtggaccagctcggc gtggaggaatccgaggtcacgccggaggcccacttcatcgacgatctcggtgcggactcg ctggacatcgtagagctcatcatggccctggaagaggaattcggcctggagatccccgac gaagaagccgagaagatcgcgacggtcaatgacgctgtcgagtacatccgctcgaactcc taa

DBGET integrated database retrieval system