Christensenella minuta: B1H56_07380 Help Entry B1H56_07380       CDS       T05665                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmiu  Christensenella minuta Pathway cmiu01100   Metabolic pathways cmiu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmiu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1H56_07380    00074 Mycolic acid biosynthesis     B1H56_07380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1H56_07380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AYH40317 UniProt:  A0A136Q804 LinkDB All DBs Position 1557028..1557261 Genome browser AA seq 77 aa AA seqDB search MFEKIVSILQEYSGEDKSLIVPEARLTADLGLNSLDVISIVVAFEDEFGVEISNEDLRTF QRVSDIEAYLEQHAARR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtttgaaaaaatcgtttccatcctacaggaatattcgggagaggataaaagccttatc gtacccgaggcgcggcttacggccgaccttgggctgaactcccttgacgtcatcagcatc gtcgtggcgtttgaggatgaatttggcgtagagatatccaacgaagacctgcgtaccttc cagcgcgtttcagatattgaggcctaccttgagcagcatgctgcaaggcgctga

DBGET integrated database retrieval system