Christensenella minuta: B1H56_11215
Help
Entry
B1H56_11215 CDS
T05665
Name
(GenBank) membrane protein insertase YidC
Organism
cmiu
Christensenella minuta
Pathway
cmiu02024
Quorum sensing
cmiu03060
Protein export
cmiu03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
cmiu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
B1H56_11215
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
B1H56_11215
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
B1H56_11215
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
60KD_IMP
RIC3
Motif
Other DBs
NCBI-ProteinID:
AYH41030
LinkDB
All DBs
Position
2348792..2349793
Genome browser
AA seq
333 aa
AA seq
DB search
MDFLYNNFLSDFFVICMKGMHNIFADYALGIVVLTILIRLCLLPLDLKQRGNQVKMAALG
PEIQSLQKRYANNPGQMQKKQQELYRKMHIHPMLGCLPMLIQLPILFAFFGAMRVIASEQ
TIALMLDAAQNGAQSVQLTPFFWVHNLWQPDSFIGGNASILPSAESFLSYVQSNQTFIQP
QTLALLHSQGLLDFSTGVMQVPADTYNALTTEILKANGYWNTVTNSVTNMNGYLILPALA
GVALFLQQKFNPAAAQNAMTSATAQTKEQQEAQGCTNKMMMWMMPIFSVFICATSNTAFA
LYWFVSSLYAFSQMKVVDLVKKAKAKKQEVSVS
NT seq
1002 nt
NT seq
+upstream
nt +downstream
nt
ttggattttctatacaataactttttatcggatttctttgtaatctgcatgaagggaatg
cacaatatttttgcggattatgcgctgggcatcgttgtccttacgattctgatccgcctg
tgcctgctgccgcttgacttaaagcagcgcggaaaccaggtaaagatggcggcgctgggg
ccggaaatccagtccctgcaaaaacgttatgcgaataatccggggcagatgcaaaaaaaa
cagcaggagttgtaccgtaaaatgcacatccatccgatgctcggatgcctgcccatgctg
atccagttgccgatcctgttcgcgttcttcggcgcgatgcgggtcatcgccagcgaacag
acgatcgctttgatgctcgatgcggcgcagaacggcgcgcaaagcgtacagcttaccccg
ttcttctgggtacacaacctctggcagccggattcgttcattggcggaaacgcgagcatc
ctgccgtcggcggaaagtttcctttcctatgtgcaatcgaaccagacgtttatccagccg
cagacgcttgcgctgctgcacagccagggcctgctcgacttttcgacgggcgtgatgcag
gtgccggccgatacgtataatgcgcttacgacggagatactcaaagcaaacggctattgg
aacaccgtgacgaattccgtgacgaatatgaacggatacctgatcctcccggcgcttgcc
ggcgtggccttgttcctgcagcagaagtttaaccccgcggccgcgcagaacgcgatgact
tcagcgacggcccaaacgaaggagcagcaggaagcgcagggctgcaccaacaagatgatg
atgtggatgatgccgattttttcggtgtttatctgcgccacatccaatacggcatttgcg
ctttactggtttgtatcgagcctgtacgcattcagccagatgaaggttgttgatctggtg
aaaaaggcaaaggcgaaaaaacaggaagtttctgtttcttaa
DBGET
integrated database retrieval system