Christensenella minuta: B1H56_11855 Help Entry B1H56_11855       CDS       T05665                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmiu  Christensenella minuta Pathway cmiu01100   Metabolic pathways cmiu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmiu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1H56_11855    00074 Mycolic acid biosynthesis     B1H56_11855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1H56_11855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AYH41147 UniProt:  A0A136Q575 LinkDB All DBs Position 2481758..2482018 Genome browser AA seq 86 aa AA seqDB search MVELERVQQLLAMASPKEIEEITPEKHLISDLEMDSFGLMEVVMAFEDEFGVEIPDRDLR LLDTVEDVLIYLEDKTGTQHMPARVF NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggtagagctggaaagggtacagcagcttctggcgatggcctctccaaaagagattgaa gagatcacgccggaaaagcatttgattagtgacctggaaatggattcgtttggactgatg gaagtcgtgatggcgtttgaagacgaattcggggtagagataccggacagggatttgcgg ctgctggatacggtagaagacgtattgatatacctcgaagacaaaacagggacgcagcat atgcccgcaagagtgttctaa

DBGET integrated database retrieval system