Cronobacter malonaticus LMG 23826: AFK66_012000 Help Entry AFK66_012000      CDS       T04062                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmj  Cronobacter malonaticus LMG 23826 Pathway cmj01100   Metabolic pathways cmj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFK66_012000    00074 Mycolic acid biosynthesis     AFK66_012000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFK66_012000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ALX79037 LinkDB All DBs Position complement(2450550..2450786) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system