Cronobacter malonaticus LMG 23826: AFK66_012175 Help Entry AFK66_012175      CDS       T04062                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism cmj  Cronobacter malonaticus LMG 23826 Brite KEGG Orthology (KO) [BR:cmj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cmj03400]     AFK66_012175 DNA repair and recombination proteins [BR:cmj03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     AFK66_012175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_PARP14_2 Motif Other DBs NCBI-ProteinID:  ALX79072 LinkDB All DBs Position 2483854..2484099 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTPLPPGAIDALACELSRRIESHFPEMPNHVSVRYAAANQLSVLGGAKEDK DRISEILQETWESADDWFTTD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtgactatcgccaaaaccacgccgctaccgccgggcgctatcgacgcg ctggcctgcgagctatcccgccgtattgaaagccattttccggaaatgccgaatcatgtg agcgtgcgttatgccgccgctaaccaactgtcggttctgggtggcgcgaaagaagataaa gatcgcatcagcgaaattctccaggaaacctgggagagcgctgacgactggtttaccact gattaa

DBGET integrated database retrieval system