KEGG   Cronobacter malonaticus LMG 23826: AFK66_012775
Entry
AFK66_012775      CDS       T04062                                 
Name
(GenBank) cysteine/glutathione ABC transporter permease/ATP-binding protein CydD
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AFK66_012775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmj02000]
    AFK66_012775
Transporters [BR:cmj02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AFK66_012775
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_21 RsgA_GTPase nSTAND1 Zeta_toxin AAA_22 MMR_HSR1 Dynamin_N AAA_29 AAA_25 AAA_16 IIGP HUTI_composite_bact
Other DBs
NCBI-ProteinID: ALX79196
LinkDB
Position
2628237..2630003
AA seq 588 aa
MNKTRQQELTRWLKQQSVISRRWLSLSRLLGVVSGLLIVAQAWLLADLLNDLIIKGIPRE
ALLLPFVLLILVFVLRAWVVWLREKVGFHAGQHIRARIRQQVMNRLQEAGPAWIQGKPAG
SWATLILEQIDDMHDFYARYLPQMALAASVPLLIVLAIFPYNWVAALILLGTAPLIPLFM
AMVGMGAADANRRNFQALARLSGNFLDRLRGMETLRLFNRGAAETHNIQAASQDFRQRTM
EVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGHYGTGVTLFAGFLALILAPEF
FQPLRDLGTFYHAKAQAVGAADSLKTFLEAPIQHAEKGTLELPGCEPISLEAQGLTVLSP
QGKRLAGPLNFTLPAGKRVAVVGQSGAGKSSLLNLLAGFLPYEGSLRVNGVELRELEPEN
WRRQLSWVGQNPQLPAGTLKDNVLLTDPEASDAQLQAALDKAWVSEFLPLLAQGVDTPIG
DQSSGLSVGQAQRVAVARALLTPCRLLLLDEPSASLDAGSERRVMQALEAASLAQTTLMV
THQIDDIAAWDEVWVMRDGRIVERGDVAALSEADGYFAALLAHRQEEI
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaataaaacccgtcaacaagaactgacccgctggcttaaacagcaaagcgttatctcc
cgccgctggctcagcctgtcgcgccttctgggcgtggtgagcggtttgcttatcgtcgcg
caggcgtggctgctggccgatctccttaacgatttgataatcaaaggcatcccgcgtgag
gcgctgctgctgccgtttgtattgttgattctggtcttcgtgttgcgggcttgggtggtg
tggctgcgcgaaaaagtcgggtttcacgccgggcaacatatccgcgcccgtattcgtcag
caggtgatgaaccgcctgcaggaggccgggccggcctggattcaagggaaacccgccggt
agctgggcgacgcttatccttgagcagattgacgatatgcacgatttctacgcccgctac
ctgccgcaaatggcgctggcggcgagcgtgccgctgctgattgtgctcgctattttccct
tataactgggtggcagcgctgatcctgcttggcaccgcgccgctaattccgctgtttatg
gcgatggtcggcatgggcgctgccgacgctaatcgccgtaacttccaggcgctggcgcgt
cttagcggcaacttccttgaccgcctgcgcggtatggagaccctgcgtcttttcaaccgc
ggcgcagcggaaacgcacaatattcaggccgcctcgcaggattttcgccagcgaacgatg
gaagtattgcgcctcgcgttcctctcctccggcgtgctggagtttttcacctcgctttcc
attgcgctggtggcggtctatttcggcttctcttatctgggtgagctgaatttcggccat
tacggcaccggcgtgacgttgttcgccggtttcctggcgctgattctggcaccggaattt
ttccagccgctacgcgatctcggcaccttttaccatgccaaagcgcaggctgtcggtgcg
gcggatagcctgaaaacattccttgaagccccgattcagcatgccgagaaaggcacgctg
gaacttcctggctgcgagccgatttcgcttgaggcgcagggcctgaccgttctttctccg
caagggaaacgtctcgccggaccgctgaatttcacgctgcctgcgggcaaacgcgtggcg
gtggtggggcaaagcggcgcgggaaaaagctcgcttttaaacctgctggccggttttttg
ccgtatgaaggctcgctgcgcgttaacggtgttgaactgcgcgagctggagcctgagaac
tggcggcgtcagttaagctgggtggggcaaaacccgcagctgcctgcggggacgcttaag
gataacgtcttactgaccgatcccgaggcgagcgacgcgcagcttcaggcggcgctggat
aaagcctgggtgagcgaattcttaccgctgctggcgcagggcgttgacacgccgattggc
gatcagtcctccggcctctctgtaggccaggcgcagcgcgtggcggttgcccgcgcgctg
ttaacgccgtgccgtttgttgctgctggatgagccttccgcaagccttgatgccggtagc
gagcgccgcgtaatgcaggcgctggaggccgcgtcgctggcgcagaccacattgatggtc
acgcaccagattgatgacatcgccgcctgggatgaagtctgggtgatgcgcgacgggcgt
atcgtggagcgcggcgacgtcgccgcgcttagcgaggccgacggttatttcgcggcgctg
ctggcgcaccgtcaggaggagatttaa

DBGET integrated database retrieval system