Callorhinchus milii (elephant shark): 103171651 Help Entry 103171651         CDS       T03088                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cmk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103171651 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmk04121]     103171651 (elob)    03400 DNA repair and recombination proteins [BR:cmk03400]     103171651 (elob) Ubiquitin system [BR:cmk04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      103171651 (elob)    Cul5 complex      103171651 (elob) DNA repair and recombination proteins [BR:cmk03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103171651 (elob) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  103171651 NCBI-ProteinID:  XP_007882630 UniProt:  V9LHT2 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKKIVEGILKRQPEDQRLFKDDQVLDDDKSLGDC GFTSQTARPQAPATIGLAFKAVDEQFEPLRIDAFSNPPELPDVMKPQDSGSSSNEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttctgatgataagacgtcacaagacaaccatttttacagacgccaaagaa tcgaccacagtttacgagctgaagaaaatcgtggagggaattctaaaacgccaaccagaa gatcagaggctttttaaggatgatcaggttttggatgatgataagtctctgggtgattgt gggttcactagtcagacagcgcgaccccaggctccagccaccatcggtctcgccttcaaa gccgtggatgagcagttcgagccgttacgtattgacgctttctcaaacccgcccgaactt cccgacgtgatgaagcctcaggattctgggagcagcagcaacgagcagtctgtgcagtga

DBGET integrated database retrieval system