Callorhinchus milii (elephant shark): 103172283 Help Entry 103172283         CDS       T03088                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk03082   ATP-dependent chromatin remodeling cmk04217   Necroptosis Brite KEGG Orthology (KO) [BR:cmk00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103172283  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103172283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmk03036]     103172283   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmk04147]     103172283 Chromosome and associated proteins [BR:cmk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103172283 Exosome [BR:cmk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103172283 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  103172283 NCBI-ProteinID:  XP_007883268 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MSGRGETGGEARAQAKSRSSRAGLQFPVGRVHRHLRKGNYADGVGAGAPVYVAAVLEYLI AEVLELAGSKKTSITPDP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgtggggagactggaggtgaagcccgggcccaggccaagtcccgctcctcc cgggccggactgcagttccccgtgggccgcgtccacagacatctccgtaaaggcaactac gctgatggcgtgggggccggagccccggtctatgtggccgcggtgctcgagtatctgatc gctgaggtgctggagctggcgggcagcaagaagaccagcatcacccccgacccctga

DBGET integrated database retrieval system