Callorhinchus milii (elephant shark): 103176633 Help Entry 103176633         CDS       T03088                                  Symbol rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04081   Hormone signaling cmk04144   Endocytosis cmk04150   mTOR signaling pathway cmk04270   Vascular smooth muscle contraction cmk04310   Wnt signaling pathway cmk04350   TGF-beta signaling pathway cmk04510   Focal adhesion cmk04517   IgSF CAM signaling cmk04519   Cadherin signaling cmk04520   Adherens junction cmk04530   Tight junction cmk04621   NOD-like receptor signaling pathway cmk04625   C-type lectin receptor signaling pathway cmk04810   Regulation of actin cytoskeleton cmk05100   Bacterial invasion of epithelial cells cmk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmk00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103176633 (rhoa)    04350 TGF-beta signaling pathway     103176633 (rhoa)    04150 mTOR signaling pathway     103176633 (rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     103176633 (rhoa)    04517 IgSF CAM signaling     103176633 (rhoa)    04519 Cadherin signaling     103176633 (rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103176633 (rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103176633 (rhoa)    04520 Adherens junction     103176633 (rhoa)    04530 Tight junction     103176633 (rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103176633 (rhoa)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103176633 (rhoa)    04625 C-type lectin receptor signaling pathway     103176633 (rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103176633 (rhoa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103176633 (rhoa)    05100 Bacterial invasion of epithelial cells     103176633 (rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmk04131]     103176633 (rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmk04147]     103176633 (rhoa)    04031 GTP-binding proteins [BR:cmk04031]     103176633 (rhoa) Membrane trafficking [BR:cmk04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103176633 (rhoa) Exosome [BR:cmk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103176633 (rhoa)   Exosomal proteins of other body fluids (saliva and urine)    103176633 (rhoa)   Exosomal proteins of colorectal cancer cells    103176633 (rhoa)   Exosomal proteins of bladder cancer cells    103176633 (rhoa) GTP-binding proteins [BR:cmk04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103176633 (rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103176633 NCBI-ProteinID:  NP_001279704 UniProt:  K4GEV1 LinkDB All DBs AA seq 193 aa AA seqDB search MAAIRRKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFVNYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVRHEEGREMVGRISAYGYMECSAKTKDGVREVFEMATKAALQ AKKCRKKHFCLML NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatacgaaggaaactggttatagttggtgatggtgcctgtggaaagacgtgt ctactaatcgtcttcagtaaagatcaattccctgaggtctacgttccaacagttttcgta aattatgtagctgatattgaagtggatggaaaacaggttgagttggctctttgggacaca gcagggcaagaagattatgatcgacttaggcctctctcctaccctgatacagatgtcatt ctaatgtgtttttctattgatagtcctgacagtttagaaaatatcccagagaagtggact ccagaggtgaaacacttttgccctaacgtgcctatcatactcgttggaaacaaaaaggac ctgagaaatgatgagcacacacgaagggaactggcaaaaatgaagcaggagcctgtgaga catgaagaaggcagagagatggtcggcaggattagtgcatatggctacatggaatgctcg gcaaaaactaaagatggcgtgagagaagttttcgaaatggctacaaaggctgccttgcaa gcaaagaagtgcaggaaaaagcatttttgtcttatgctataa

DBGET integrated database retrieval system