Callorhinchus milii (elephant shark): 103176674 Help Entry 103176674         CDS       T03088                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04137   Mitophagy - animal cmk04140   Autophagy - animal cmk04144   Endocytosis cmk04145   Phagosome cmk04148   Efferocytosis cmk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmk00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103176674 (rab7a)    04145 Phagosome     103176674 (rab7a)    04140 Autophagy - animal     103176674 (rab7a)    04137 Mitophagy - animal     103176674 (rab7a)    04148 Efferocytosis     103176674 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103176674 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmk04131]     103176674 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmk04147]     103176674 (rab7a)    04031 GTP-binding proteins [BR:cmk04031]     103176674 (rab7a) Membrane trafficking [BR:cmk04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103176674 (rab7a) Exosome [BR:cmk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103176674 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    103176674 (rab7a)   Exosomal proteins of colorectal cancer cells    103176674 (rab7a)   Exosomal proteins of bladder cancer cells    103176674 (rab7a) GTP-binding proteins [BR:cmk04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103176674 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  103176674 NCBI-ProteinID:  XP_042195601 UniProt:  V9KR15 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgctgttgaaagtcattattttgggagattcaggggtgggg aagacctcgctgatgaaccagtatgtcaacaaaaagttcagtaaccagtataaggcgacg ataggggcagactttctaacaaaggaggtgatggttgatgatcgattggtgactatgcag atttgggatacagcagggcaagagaggttccagtcgctgggagtggcgttctacagagga gctgactgctgtgtgttggtctttgatgtgaccgctcccaacacgttcaaaactctcgat agctggagggacgagtttctcattcaagccagtccacgagatcctgaaaacttccccttt gttgtccttggaaacaagatagacttagaaaatagacaagtcaccacaaaaagggcacaa gcatggtgtcagagtaaaaataacatcccctactttgaaaccagcgcaaaggaagcaata aatgtggaacaggcttttcaaaccattgcaaggaatgcacttaaacaggaaactgaagtg gaactctacaacgaattcccagagccaatcaaactagacaagaacgaccgagcgaagact tcagcagagagttgcagctgctga

DBGET integrated database retrieval system