Callorhinchus milii (elephant shark): 103178867 Help Entry 103178867         CDS       T03088                                  Symbol nxt2 Name (RefSeq) NTF2-related export protein 2   KO K14285   NTF2-related export protein 1/2 Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk03008   Ribosome biogenesis in eukaryotes cmk03013   Nucleocytoplasmic transport cmk03015   mRNA surveillance pathway Brite KEGG Orthology (KO) [BR:cmk00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     103178867 (nxt2)    03015 mRNA surveillance pathway     103178867 (nxt2)    03008 Ribosome biogenesis in eukaryotes     103178867 (nxt2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmk03019]     103178867 (nxt2)    03009 Ribosome biogenesis [BR:cmk03009]     103178867 (nxt2) Messenger RNA biogenesis [BR:cmk03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      103178867 (nxt2) Ribosome biogenesis [BR:cmk03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     103178867 (nxt2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Motif Other DBs NCBI-GeneID:  103178867 NCBI-ProteinID:  XP_007892020 UniProt:  V9LDA2 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MLVNENLVLTKLYLDTANLVWNGNAVSGNRALADFFEMLPSSDFQVNMLDCQPVHEQATQ GQTTVLVVTCGTVKFDGNQQRYFNQNFLLTAQVTPQNTVWKIASDCFRFQDWPS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgttggtgaacgagaatctggtgctcaccaaattgtacttggacacagccaacctagtg tggaacggcaatgccgtgtccggcaaccgagccctcgccgatttcttcgagatgctgcca tccagcgatttccaagtgaacatgttggattgccagccggtccacgagcaagctactcaa gggcagacgactgtgcttgtggtcacgtgcgggacagtgaagttcgatgggaaccagcag cgctacttcaaccagaatttcctgctgacggcgcaggtcacgcctcagaacacggtgtgg aaaatagccagcgattgcttccgcttccaggactggcccagttaa

DBGET integrated database retrieval system