Callorhinchus milii (elephant shark): 103182053 Help Entry 103182053         CDS       T03088                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04382   Cornified envelope formation cmk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmk00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103182053  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103182053  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmk04147]     103182053 Exosome [BR:cmk04147]  Exosomal proteins   Exosomal proteins of microglial cells    103182053 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 SPARC_Ca_bdg EF-hand_5 Put_Phosphatase Motif Other DBs NCBI-GeneID:  103182053 NCBI-ProteinID:  XP_007897097 UniProt:  V9LCN3 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MTSTACIVPSPLEMAMEHLIDVFGQYSQKDQMKQTLNKQQLRKLMDEQLTTLMQHHNNQK AIDNVFKDLDFDGDGLVAFEEFLSLVAGLTKSCNDRLLIKEHKRLTSQTKQ NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgacgagtacagcgtgcattgtcccttcccccctggagatggccatggagcatctgatc gacgtctttggccagtactcccagaaggaccaaatgaaacagactctgaacaagcagcag ctcaggaagctgatggacgagcaactgaccacactcatgcagcaccacaacaaccaaaag gccatcgacaatgtgtttaaagacttggatttcgacggggacgggctggtggccttcgaa gagttcctgtccttggtcgctggtctcaccaaatcctgcaatgatcgcctacttattaaa gagcacaaacgcttgactagccagaccaaacaatga

DBGET integrated database retrieval system