Callorhinchus milii (elephant shark): 103184246 Help Entry 103184246         CDS       T03088                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cmk00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     103184246 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmk03036]     103184246 (cenps)    03400 DNA repair and recombination proteins [BR:cmk03400]     103184246 (cenps) Chromosome and associated proteins [BR:cmk03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      103184246 (cenps) DNA repair and recombination proteins [BR:cmk03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      103184246 (cenps) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TPR_26 TFIID-31kDa Motif Other DBs NCBI-GeneID:  103184246 NCBI-ProteinID:  XP_007900348 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MAAAAERDRAAHTQRLRAAVHYTVGCLCQEVGEDKGKEFNKQTIAAIAETTFRQCEIFAQ DLELFSRHGKRSTVNTEDVKLLSRRSTALQKFITKKCDDLASDNVEKKTLFTAGKGKKKS NVQTESTVTESDDTCME NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggagcgggacagggccgcgcacacccagagacttcgagctgcagtg cactacaccgttggatgtctttgtcaagaggttggggaagacaaaggaaaagagttcaac aaacaaaccattgcagccatagcagaaacaaccttccgacagtgtgaaatttttgcacag gatcttgaactattttcaagacatggaaagcgaagcactgttaatactgaagatgtgaaa ctcctgtctagaaggagcacagcgttgcaaaaattcataacaaagaagtgtgatgacctt gcatccgataatgtggagaagaagacattgtttactgcagggaaaggaaagaagaaatct aatgttcagactgaatccacagtaactgaaagtgacgacacttgtatggagtag

DBGET integrated database retrieval system