Callorhinchus milii (elephant shark): 103184455 Help Entry 103184455         CDS       T03088                                  Symbol pfn2a Name (RefSeq) profilin 2a isoform X1   KO K05759   profilin Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04810   Regulation of actin cytoskeleton cmk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmk00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103184455 (pfn2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103184455 (pfn2a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmk04131]     103184455 (pfn2a)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cmk04812]     103184455 (pfn2a)    04147 Exosome [BR:cmk04147]     103184455 (pfn2a) Membrane trafficking [BR:cmk04131]  Others   Actin-binding proteins    Others     103184455 (pfn2a) Cytoskeleton proteins [BR:cmk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103184455 (pfn2a) Exosome [BR:cmk04147]  Exosomal proteins   Proteins found in most exosomes    103184455 (pfn2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103184455 NCBI-ProteinID:  XP_042195251 UniProt:  V9L872 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MSGWNGYVDSLMADGYCQDSAIVGYTDAKYVWASMPSGTFSFISPQEIDVITGKDRQGFF TNGLTLGGKKCSVIRDSLFVDGDCTMDIRTKSQAGEPTFNVAVGRAGKTLVIVMGKNSVH GGQLNKKIYEMIGHLKGAGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtctggctggaacggttatgtggacagcctgatggcggacggttactgccaggactcg gccatcgtcggctacacggacgccaaatacgtctgggcttccatgccctcgggcaccttc tccttcatatcgcctcaagaaatagatgtgataactggaaaagatcgtcaaggtttcttc accaatggcttgaccttaggtggaaagaagtgctctgttatcagagatagcttgtttgtt gatggcgactgcacgatggatatcaggacaaagagccaagctggagaaccaacattcaac gttgctgtaggcagagctggcaaaacattggttatagtcatgggaaagaattctgtccat ggagggcaactcaacaagaaaatatatgaaatgattggacacctgaagggagctggattc taa

DBGET integrated database retrieval system