Callorhinchus milii (elephant shark): 103186003 Help Entry 103186003         CDS       T03088                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04010   MAPK signaling pathway cmk04068   FoxO signaling pathway cmk04081   Hormone signaling cmk04114   Oocyte meiosis cmk04140   Autophagy - animal cmk04150   mTOR signaling pathway cmk04810   Regulation of actin cytoskeleton cmk04910   Insulin signaling pathway cmk04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cmk00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103186003 (ins)    04150 mTOR signaling pathway     103186003 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     103186003 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103186003 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmk04052]     103186003 (ins) Cytokines and neuropeptides [BR:cmk04052]  Neuropeptides   Unclassified    103186003 (ins) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  103186003 NCBI-ProteinID:  XP_007902984 UniProt:  A0A4W3I9K0 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MMLWNRFGFVALLMALSGPKPSETVPTQRLCGSHLVDALYFVCGERGFFYSPKQIRDVGP LSAFRDLEPPLDTEMEDRFPHRQQLAGSKMKRGIVEQCCHNTCSLVNLEGYCN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgatgctctggaatcgctttgggttcgtggctctgttgatggctctctccggcccgaag ccgtccgagacagtaccaacccaacgcctctgtggctctcacctggtggacgctctgtac tttgtgtgcggagaaaggggcttcttctactcacccaaacagataagggacgtggggccg ctttcggcattccgagacctagagcccccgctggatactgagatggaggacaggtttccc caccggcagcagttggctgggagtaaaatgaagcgaggaatcgtcgagcaatgctgccat aacacgtgctccctggtgaacctcgagggctactgtaactaa

DBGET integrated database retrieval system