Carnobacterium maltaromaticum: BN424_269 Help Entry BN424_269         CDS       T02342                                  Symbol tyrA Name (GenBank) chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism cml  Carnobacterium maltaromaticum Pathway cml00400   Phenylalanine, tyrosine and tryptophan biosynthesis cml01100   Metabolic pathways cml01110   Biosynthesis of secondary metabolites cml01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:cml00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BN424_269 (tyrA) Enzymes [BR:cml01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BN424_269 (tyrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  CCO09749 UniProt:  K8E1Q9 LinkDB All DBs Position 306826..307101 Genome browser AA seq 91 aa AA seqDB search MLDKQRAEIDQIDRELVALFERRMAIVTEIGEIKKANSLPIFDEAREINVMERAEERLAN SDYAPYVGQLFKDLMNVTKEYQKNIVKKREL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgttagacaaacaaagagcagagattgatcaaattgatcgcgaattagtggctttattt gaacgtagaatggcaattgtgacagaaataggggaaataaaaaaagcgaatagtttgcca atatttgatgaagcacgggaaattaatgtgatggaacgcgcagaagagcgattggctaat tctgattatgcaccttatgtagggcaactatttaaagacttaatgaatgtaacaaaagag taccaaaaaaatatagtaaaaaaacgagaactataa

DBGET integrated database retrieval system