Cucumis melo (muskmelon): 103488398 Help Entry 103488398         CDS       T03195                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmo  Cucumis melo (muskmelon) Pathway cmo04145   Phagosome cmo04148   Efferocytosis cmo04620   Toll-like receptor signaling pathway cmo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmo00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103488398    04148 Efferocytosis     103488398  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103488398  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103488398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmo04131]     103488398   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmo04147]     103488398    04031 GTP-binding proteins [BR:cmo04031]     103488398 Membrane trafficking [BR:cmo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103488398  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103488398   Macropinocytosis    Ras GTPases     103488398  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103488398 Exosome [BR:cmo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103488398   Exosomal proteins of other body fluids (saliva and urine)    103488398   Exosomal proteins of colorectal cancer cells    103488398   Exosomal proteins of bladder cancer cells    103488398 GTP-binding proteins [BR:cmo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103488398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  103488398 NCBI-ProteinID:  XP_008445333 UniProt:  A0A1S3BCF2 LinkDB All DBs Position 3:26138776..26141973 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELRKVIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PKSKKKKKKSQNVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgtaacggttggtgatggggctgtgggtaaaacc tgtatgttgatttcatatacgagtaacacctttcccacggactacgtgcctacggttttt gacaatttcagtgccaatgtggtggttgatggaagcacggtcaacctaggactatgggat actgctggtcaagaggattacaatagattaagaccactgagctacagaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgagacattatgcacctggtgttccaatagtcctcgttggaactaaactt gatcttcgggatgacaagcagttctttgtagaccaccctggtgcagtgcccatttccact gttcagggtgaggagttgagaaaagttatcggagctccagcatacatcgagtgtagttca aaaacccagcagaatgtgaaaggggtgttcgatgcagccattaaagtggtgctccagccg ccaaagtctaagaagaagaagaagaagtcacagaatgtctgttccatcttatga

DBGET integrated database retrieval system