Cucumis melo (muskmelon): 103488398 Help Entry 103488398         CDS       T03195                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmo  Cucumis melo (muskmelon) Pathway cmo04145   Phagosome cmo04148   Efferocytosis cmo04517   IgSF CAM signaling cmo04518   Integrin signaling cmo04620   Toll-like receptor signaling pathway cmo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103488398    04518 Integrin signaling     103488398  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103488398    04148 Efferocytosis     103488398  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103488398  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103488398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmo04131]     103488398   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmo04147]     103488398    04031 GTP-binding proteins [BR:cmo04031]     103488398 Membrane trafficking [BR:cmo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103488398  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103488398   Macropinocytosis    Ras GTPases     103488398  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103488398 Exosome [BR:cmo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103488398   Exosomal proteins of other body fluids (saliva and urine)    103488398   Exosomal proteins of colorectal cancer cells    103488398   Exosomal proteins of bladder cancer cells    103488398 GTP-binding proteins [BR:cmo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103488398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU VMAP-M7 AAA_7 Motif Other DBs NCBI-GeneID:  103488398 NCBI-ProteinID:  XP_008445333 UniProt:  A0A1S3BCF2 LinkDB All DBs Position 3:26138776..26141973 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELRKVIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PKSKKKKKKSQNVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgtaacggttggtgatggggctgtgggtaaaacc tgtatgttgatttcatatacgagtaacacctttcccacggactacgtgcctacggttttt gacaatttcagtgccaatgtggtggttgatggaagcacggtcaacctaggactatgggat actgctggtcaagaggattacaatagattaagaccactgagctacagaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgagacattatgcacctggtgttccaatagtcctcgttggaactaaactt gatcttcgggatgacaagcagttctttgtagaccaccctggtgcagtgcccatttccact gttcagggtgaggagttgagaaaagttatcggagctccagcatacatcgagtgtagttca aaaacccagcagaatgtgaaaggggtgttcgatgcagccattaaagtggtgctccagccg ccaaagtctaagaagaagaagaagaagtcacagaatgtctgttccatcttatga

DBGET integrated database retrieval system