Cucumis melo (muskmelon): 103491266 Help Entry 103491266         CDS       T03195                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cmo  Cucumis melo (muskmelon) Pathway cmo04016   MAPK signaling pathway - plant cmo04070   Phosphatidylinositol signaling system cmo04075   Plant hormone signal transduction cmo04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cmo00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     103491266    04070 Phosphatidylinositol signaling system     103491266    04075 Plant hormone signal transduction     103491266  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     103491266  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmo01009]     103491266   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmo04131]     103491266    03036 Chromosome and associated proteins [BR:cmo03036]     103491266   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmo04147]     103491266 Protein phosphatases and associated proteins [BR:cmo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103491266 Membrane trafficking [BR:cmo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103491266 Chromosome and associated proteins [BR:cmo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103491266 Exosome [BR:cmo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103491266 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C DUF5580_M EF-hand_11 SurA_N_3 YqeY PA_Ig-like Motif Other DBs NCBI-GeneID:  103491266 NCBI-ProteinID:  XP_008449367 UniProt:  A0A1S3BL89 LinkDB All DBs Position 5:complement(3845935..3847792) Genome browser AA seq 149 aa AA seqDB search MAAEALTEDQIADFREAFCLIDKDADGFITVEELGAVIQSLDVHPTKNEIRDMISEVDVD NNGTIDFDEFLNVMARKMKDNVTEELKEAFKVFDRDQDGYISAFELRNVMINLGERLTDD EAEQMIREADLDGDGRVSYEEFARIMTIS NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaagctcttacagaagatcaaatcgctgattttcgtgaagccttttgttta atcgacaaggatgcggatggattcatcactgtggaagagctaggggcagtaattcagtcg ttggatgtacatcccaccaagaatgaaattagagatatgataagtgaagttgatgttgat aataacgggacgatagattttgacgagtttctaaatgtcatggctaggaaaatgaaggac aatgttactgaggagctaaaagaagccttcaaagtgtttgatagagaccaagatggttat atctcagcttttgagttgagaaatgtaatgataaatttgggagagagattgacagacgac gaggcagaacaaatgattcgagaagccgatttggatggcgatgggcgagtgagttacgaa gagtttgccaggataatgacaatcagttga

DBGET integrated database retrieval system