Cucumis melo (muskmelon): 103491421 Help Entry 103491421         CDS       T03195                                  Name (RefSeq) DNA polymerase II subunit B4   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism cmo  Cucumis melo (muskmelon) Pathway cmo03030   DNA replication cmo03082   ATP-dependent chromatin remodeling cmo03410   Base excision repair cmo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cmo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103491421    03410 Base excision repair     103491421    03420 Nucleotide excision repair     103491421   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103491421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cmo03032]     103491421    03036 Chromosome and associated proteins [BR:cmo03036]     103491421    03400 DNA repair and recombination proteins [BR:cmo03400]     103491421 Enzymes [BR:cmo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      103491421 DNA replication proteins [BR:cmo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     103491421 Chromosome and associated proteins [BR:cmo03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     103491421 DNA repair and recombination proteins [BR:cmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       103491421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TrmB DUF5427 TAFII28 Bromo_TP Pox_Ag35 Motif Other DBs NCBI-GeneID:  103491421 NCBI-ProteinID:  XP_008449581 UniProt:  A0A1S3BNA4 LinkDB All DBs Position 5:1882668..1885329 Genome browser AA seq 155 aa AA seqDB search MEKKIVAGIEELPKTIVRRVVKEKLSQCSRDQDISVNKDSLLAFCESARIFIHYLSATAN DICKESKRQTIKAEDVLKALEDMEFPELVRPLKASLNEFRRKNAGKKAAASREKEVKKKR KVEEPTVEGTDGESIDGVGDDDNDEDEDENEASDN NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggagaaaaaaatagttgccggaattgaagagcttccaaagactatagttcgtcgagtg gtcaaagagaagctttctcagtgctctcgtgaccaggacatctccgtcaacaaagactcg cttcttgcgttttgcgagagcgctcgaatcttcatccattacctctccgctacggcgaat gatatatgcaaggaatcaaagaggcagacgattaaggcggaagatgtattgaaagcttta gaagatatggagtttccagaattggttaggcctctaaaggcctccctcaatgaattcaga cgcaagaatgctggaaagaaggcagctgcatcaagagaaaaagaagtgaaaaagaaaagg aaggtagaagagccaacagttgaaggtacagatggtgaaagtatagatggcgttggagat gatgataatgatgaagatgaggatgaaaacgaggccagtgataactga

DBGET integrated database retrieval system