Cucumis melo (muskmelon): 103499918 Help Entry 103499918         CDS       T03195                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism cmo  Cucumis melo (muskmelon) Pathway cmo03018   RNA degradation cmo03040   Spliceosome Brite KEGG Orthology (KO) [BR:cmo00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     103499918   09123 Folding, sorting and degradation    03018 RNA degradation     103499918  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmo03019]     103499918    03041 Spliceosome [BR:cmo03041]     103499918 Messenger RNA biogenesis [BR:cmo03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      103499918   mRNA degradation factors    5'-3' decay     Lsm complex      103499918 Spliceosome [BR:cmo03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     103499918  Complex C   U2 snRNP components     103499918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C Motif Other DBs NCBI-GeneID:  103499918 NCBI-ProteinID:  XP_008461281 UniProt:  A0A1S3CDX8 LinkDB All DBs Position 1:complement(34530073..34532059) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgtttttctcgtacttcaaggatttggtgggcagagaggtgacagttgagttgaag aacgacctagcaattagaggaaccctgcattctgtagatcagtatctcaacatcaaactg gaaaacaccagggttgttgatcaagacaaataccctcacatgctctctgtgagaaactgt ttcatcaggggatcagtggtgagatatgttcaacttccaccagatggtgttgatgtcgag ttgttgcatgatgccaccagacgcgaggctcgaggtggctaa

DBGET integrated database retrieval system