Cucumis melo (muskmelon): 103501992 Help Entry 103501992         CDS       T03195                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cmo  Cucumis melo (muskmelon) Pathway cmo04136   Autophagy - other Brite KEGG Orthology (KO) [BR:cmo00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     103501992  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmo04131]     103501992    04121 Ubiquitin system [BR:cmo04121]     103501992    03029 Mitochondrial biogenesis [BR:cmo03029]     103501992 Membrane trafficking [BR:cmo04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     103501992 Ubiquitin system [BR:cmo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    103501992 Mitochondrial biogenesis [BR:cmo03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     103501992 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  103501992 NCBI-ProteinID:  XP_008464001 UniProt:  A0A1S3CKI1 LinkDB All DBs Position 4:18443747..18446494 Genome browser AA seq 95 aa AA seqDB search MTSTESSTSARKVVVLLRATGDAPILKQTKFKMPGTDKFIKVIDYIRRSIQRDTLFVFVN SAFSPGPDETVIDLYNNFGIDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacttctacagagtcgtccacttctgctcgaaaagtggttgtcctgttgagagcaact ggggatgctcccattctcaaacaaactaagtttaagatgcctggcacagacaaatttatt aaagttattgattatatacgccggtccattcaacgggacaccttgtttgtatttgtcaac agtgcattctcaccgggtccagatgagacagttattgatctatataataactttggaatt gatgggaagttggtggtaaattatgcctgctccatggcttggggctaa

DBGET integrated database retrieval system