Cucumis melo (muskmelon): 11123058 Help Entry 11123058          CDS       T03195                                  Symbol atpH, CumesmeC_p008 Name (RefSeq) ATP synthase CF0 subunit III   KO K02110   F-type H+-transporting ATPase subunit c Organism cmo  Cucumis melo (muskmelon) Pathway cmo00190   Oxidative phosphorylation cmo00195   Photosynthesis cmo01100   Metabolic pathways Module cmo_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cmo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     11123058 (atpH)    00195 Photosynthesis     11123058 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cmo00194]     11123058 (atpH) Photosynthesis proteins [BR:cmo00194]  Photosystem and electron transport system   F-type ATPase [OT]    11123058 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  11123058 NCBI-ProteinID:  YP_004841770 UniProt:  A0A1S4ETZ4 G3ETX2 LinkDB All DBs Position Pltd:complement(14343..14588) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctgggttggccgtcgggcttgct tctattggacctgggattggtcaaggtactgctgcgggccaagctgtagaagggatcgcg agacaacccgaggcggagggaaaaatccgaggtactttattgcttagtctggcttttatg gaagctttaacaatttatggactagttgtagcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system