Campylobacter molothri: CMOL_0221 Help Entry CMOL_0221         CDS       T10922                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmol  Campylobacter molothri Pathway cmol01100   Metabolic pathways cmol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMOL_0221 (acpP1)    00074 Mycolic acid biosynthesis     CMOL_0221 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMOL_0221 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  ULN99416 LinkDB All DBs Position 219009..219242 Genome browser AA seq 77 aa AA seqDB search MATFDDVKAVVVEQLSIDADTVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAE KLIKIEDVVNYIDNLKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaacatttgatgatgtaaaagcggtagtagtagaacaattaagtattgatgcagat acagttaaaatggaatctaaaattattgaagatttaggtgcagattctttggatgtcgta gaattaattatggctttagaagaaaaatttgaagttgaaattccagatagtgatgctgaa aaacttattaaaattgaagatgttgtaaattatattgataatcttaaaaaataa

DBGET integrated database retrieval system