Caldicellulosiruptor morganii: OTK00_001711 Help Entry OTK00_001711      CDS       T08774                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism cmor  Caldicellulosiruptor morganii Pathway cmor00010   Glycolysis / Gluconeogenesis cmor00020   Citrate cycle (TCA cycle) cmor00620   Pyruvate metabolism cmor00633   Nitrotoluene degradation cmor00640   Propanoate metabolism cmor00650   Butanoate metabolism cmor00680   Methane metabolism cmor00720   Other carbon fixation pathways cmor01100   Metabolic pathways cmor01110   Biosynthesis of secondary metabolites cmor01120   Microbial metabolism in diverse environments cmor01200   Carbon metabolism cmor01210   2-Oxocarboxylic acid metabolism Module cmor_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:cmor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     OTK00_001711    00020 Citrate cycle (TCA cycle)     OTK00_001711    00620 Pyruvate metabolism     OTK00_001711    00640 Propanoate metabolism     OTK00_001711    00650 Butanoate metabolism     OTK00_001711   09102 Energy metabolism    00720 Other carbon fixation pathways     OTK00_001711    00680 Methane metabolism     OTK00_001711   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     OTK00_001711 Enzymes [BR:cmor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      OTK00_001711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_7 LdpA_Fe-S-bd Fer4_9 Fer4_4 Fer4_16 Fer4_3 Fer4_15 Fer4_8 Fer4_17 Fer4_13 Motif Other DBs NCBI-ProteinID:  WAM33227 UniProt:  A0ABY7BMW7 LinkDB All DBs Position complement(1721513..1721812) Genome browser AA seq 99 aa AA seqDB search MRKMKITEEVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS SIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagaaagatgaaaataacagaagaggttacatggaaggaaataacaccggcgggtgta ataattgacccgggtaatgcagaggacttcaagacaggcgattggagaactatgagacct gtctggcacgaagacaagtgcaaacagtgcctgttttgcttctatgtatgtccggattca tcaataaaagtagaaaatggcaaaatggttggagttgactatgaccactgcaagggctgt ggcgtttgcacagaggtttgcccatttaaggcatttgattttgtagaagagaagaaataa

DBGET integrated database retrieval system