Cucurbita moschata (crookneck pumpkin): 111431794 Help Entry 111431794         CDS       T05248                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos04145   Phagosome cmos04148   Efferocytosis cmos04620   Toll-like receptor signaling pathway cmos05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmos00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111431794    04148 Efferocytosis     111431794  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111431794  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111431794  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmos04131]     111431794   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmos04147]     111431794    04031 GTP-binding proteins [BR:cmos04031]     111431794 Membrane trafficking [BR:cmos04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111431794  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111431794   Macropinocytosis    Ras GTPases     111431794  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111431794 Exosome [BR:cmos04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111431794   Exosomal proteins of other body fluids (saliva and urine)    111431794   Exosomal proteins of colorectal cancer cells    111431794   Exosomal proteins of bladder cancer cells    111431794 GTP-binding proteins [BR:cmos04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111431794 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Sua5_C Motif Other DBs NCBI-GeneID:  111431794 NCBI-ProteinID:  XP_022924269 UniProt:  A0A6J1E8N6 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MAGGAATASASAQTAATKFIKCVMVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANV LVNGQSVNLGLWDTAGQEDYSRLRPLSYRGADVFLLAFSLISRASFENISKKWIPELRHY APSVPIILVGTKLDLRDNEQFLLDYPGACTISTKQGEELKKLIGAVAFIECSSKTQQNVK AVFDAAVKVVLQPPKPKRPKRKHPTCNFL NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggccggcggcgccgccactgcttcggcaagtgcacagacggcggcaacgaagtttatt aagtgcgtgatggttggagatggcgccgttgggaagacttgccttctcatttcttacact agcaacacttttccgactgattatgttcctactgttttcgacaatttcagcgccaatgtt ttggttaatggccaatctgtgaatttaggtctctgggacactgcgggtcaagaagattat agcaggctaagacctttgagctacagaggagctgatgttttccttcttgccttttcgctc ataagtagggccagctttgaaaatatatcaaagaaatggatcccagagttgaggcattat gccccatcagtgcccattattcttgtagggaccaaactagatctgagagacaatgaacaa ttcctcttggactatcctggggcatgtacaatatcgacgaaacagggcgaggagctaaag aagcttattggagcagtggcattcattgagtgcagttcaaagacacaacagaatgtaaag gctgtgtttgatgctgcagtcaaggtggttcttcaacctccaaaacccaaaaggccaaag agaaaacatccaacctgcaattttctctga

DBGET integrated database retrieval system