Cucurbita moschata (crookneck pumpkin): 111432430 Help Entry 111432430         CDS       T05248                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos04016   MAPK signaling pathway - plant cmos04070   Phosphatidylinositol signaling system cmos04075   Plant hormone signal transduction cmos04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cmos00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     111432430    04070 Phosphatidylinositol signaling system     111432430    04075 Plant hormone signal transduction     111432430  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     111432430  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmos01009]     111432430   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmos04131]     111432430    03036 Chromosome and associated proteins [BR:cmos03036]     111432430   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmos04147]     111432430 Protein phosphatases and associated proteins [BR:cmos01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111432430 Membrane trafficking [BR:cmos04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111432430 Chromosome and associated proteins [BR:cmos03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111432430 Exosome [BR:cmos04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111432430 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 EF-hand_11 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C PA_Ig-like Fe_hyd_lg_C PhageMin_Tail SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  111432430 NCBI-ProteinID:  XP_022925074 UniProt:  A0A6J1GFV9 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcaactcaccgacgatcagatctctgagttcaaggaggccttcagcttgttc gacaaggatggcgacggttgtatcacaaccaaggagcttggtactgttatgaggtcacta ggtcagaatccaaccgaagcggagcttcaggacatgattaatgaggtcgatgctgatggc aatggaacaatcgactttcccgagttcctaaacctcatggctaggaagatgaaggatacg gattccgaggaggagttgaaagaggcattccgagtcttcgataaggaccagaatggcttc atctccgctgctgagctccgccatgtgatgaccaatctcggcgagaaactgaccgaggag gaggtcgatgagatgatcagagaggccgatgtggatggcgatggccagattaactacgac gaattcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system