Cucurbita moschata (crookneck pumpkin): 111443863 Help Entry 111443863         CDS       T05248                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism cmos  Cucurbita moschata (crookneck pumpkin) Brite KEGG Orthology (KO) [BR:cmos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cmos03041]     111443863   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmos04052]     111443863 Spliceosome [BR:cmos03041]  Complex B   Other components    Complex B specific factors     111443863 Cytokines and neuropeptides [BR:cmos04052]  Neuropeptides   Unclassified    111443863 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  111443863 NCBI-ProteinID:  XP_022937457 UniProt:  A0A6J1FIJ0 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggttctcaacgatcgtctagggaagaaggtccgggtgaagtgcaacgag gacgacacgatcggcgacttgaagaagctcgttgccgctcagaccggaaccagggccgag aagatcaggatccagaagtggtacaatatctacaaggatcacatcaccctcaaggattac gagatccatgatggcatgggtctcgagctctattacaactga

DBGET integrated database retrieval system