Cucurbita moschata (crookneck pumpkin): 111454197 Help Entry 111454197         CDS       T05248                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos04145   Phagosome cmos04148   Efferocytosis cmos04517   IgSF CAM signaling cmos04518   Integrin signaling cmos04620   Toll-like receptor signaling pathway cmos05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cmos00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     111454197    04518 Integrin signaling     111454197  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111454197    04148 Efferocytosis     111454197  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111454197  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111454197  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmos04131]     111454197   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmos04147]     111454197    04031 GTP-binding proteins [BR:cmos04031]     111454197 Membrane trafficking [BR:cmos04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111454197  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111454197   Macropinocytosis    Ras GTPases     111454197  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111454197 Exosome [BR:cmos04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111454197   Exosomal proteins of other body fluids (saliva and urine)    111454197   Exosomal proteins of colorectal cancer cells    111454197   Exosomal proteins of bladder cancer cells    111454197 GTP-binding proteins [BR:cmos04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111454197 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  111454197 NCBI-ProteinID:  XP_022951334 UniProt:  A0A6J1GID5 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELTKTIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKSKKKKKKSQSVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgttacggtgggcgatggtgctgtgggtaaaacc tgtatgttgatttcttatacgagtaacacctttcccacggactacgtgcccaccgttttt gacaatttcagtgccaatgtggtggttgatggaaacactgtcaacttaggattatgggat actgctggtcaagaggattacaatagattaagaccactgagttatcgaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgctaagaagtgg attcctgagttgagacattatgcacctggtgttccaatagttcttgttggaactaaactt gatcttcgggatgacaagcaattctttgtagaccacccgggtgcggtgccaatttctact gttcagggagaggagttgacaaaaacaattggagccccggcatacatcgaatgtagttca aaaactcagcagaatgtgaaagcagtgtttgatgcagccattaaagtggtgctccagccg cccaagtcaaagaagaagaagaagaagtcacagagtgtctgttccatcttatga

DBGET integrated database retrieval system