Cucurbita moschata (crookneck pumpkin): 111457277 Help Entry 111457277         CDS       T05248                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cmos00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     111457277  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmos03036]     111457277    03400 DNA repair and recombination proteins [BR:cmos03400]     111457277 Chromosome and associated proteins [BR:cmos03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      111457277 DNA repair and recombination proteins [BR:cmos03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      111457277 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  111457277 NCBI-ProteinID:  XP_022955266 UniProt:  A0A6J1GTB4 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search METGMEEDDSTAELLRGRFRLSAISIAEAEAKRSGMEISVPVMTCVAELAFKYTKQLAKD LELFAHHGGRKSVNTEDVILSAHRNEHLAASLSSFCHELKTKEPQSERKRKKAPKKEDKS AIHITDA NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggagactgggatggaagaagacgactccacggccgaactcttgaggggccgattccga ctgtccgccatttctatcgctgaagctgaagcgaagagaagcgggatggaaatctctgta ccggtgatgacttgtgtcgctgagttagcgttcaaatatacaaaacagttggcaaaggac cttgagttatttgctcatcatggtggtcggaaatctgtgaatacggaagacgtcatactc tcagctcatagaaacgagcatctggctgcctcattgtcgtccttctgccatgaactaaag acaaaagaacctcaaagtgagagaaagcggaaaaaggcaccgaaaaaggaagataaaagt gcaatacatattactgacgcataa

DBGET integrated database retrieval system