Cucurbita moschata (crookneck pumpkin): 111457534 Help Entry 111457534         CDS       T05248                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos04136   Autophagy - other Brite KEGG Orthology (KO) [BR:cmos00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     111457534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmos04131]     111457534    04121 Ubiquitin system [BR:cmos04121]     111457534    03029 Mitochondrial biogenesis [BR:cmos03029]     111457534 Membrane trafficking [BR:cmos04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     111457534 Ubiquitin system [BR:cmos04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    111457534 Mitochondrial biogenesis [BR:cmos03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     111457534 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 VpsT-like_REC Motif Other DBs NCBI-GeneID:  111457534 NCBI-ProteinID:  XP_022955552 UniProt:  A0A6J1GTZ1 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MASMESSSSAKKVVVLLRSIGDAPILKQNKFKMPGTDKFIKVIDYIRRSIQRDTLFVFVN SAFSPGPDETVIDLYNNFGIDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcttctatggagtcgtctagttctgctaagaaagtggttgttctgctgcgatctatt ggggatgctcccattctcaaacaaaacaagtttaagatgcctggaacagacaaatttatt aaagtgattgattatatacgtcggtcaatccaacgggacaccttgtttgtgtttgtcaac agtgcattctcacctggtccagatgagacagttattgatctatataataactttggaatt gatgggaagttggtcgtaaattatgcttgctcgatggcttggggataa

DBGET integrated database retrieval system