Corynebacterium marinum: B840_05550
Help
Entry
B840_05550 CDS
T03633
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
cmq
Corynebacterium marinum
Pathway
cmq00770
Pantothenate and CoA biosynthesis
cmq01100
Metabolic pathways
cmq01240
Biosynthesis of cofactors
Module
cmq_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
cmq00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
B840_05550 (coaD)
Enzymes [BR:
cmq01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
B840_05550 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AJK68723
UniProt:
A0A0B6TL95
LinkDB
All DBs
Position
1141586..1142071
Genome browser
AA seq
161 aa
AA seq
DB search
MKAVCPGSFDPVTMGHLDIYRRAAAHFDEVVVLVTGNPSKKSGLFTIDERMELIREVTSD
VPNLRVDWWGGLLVDYTTEHGIHALVKGLRTALDYEYELPMAQMNRRLTGIDTFFLLTDE
KYGYISSSLLKEVAKYGGDVHGLLPDAVVDAVKEKYRTIDG
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
gtgaaagccgtctgccccggttccttcgacccggtgaccatgggccacctggacatctac
cgccgcgccgccgcccacttcgacgaggtcgtcgtgctggtgaccggtaaccccagcaag
aagtccggcctgttcaccatcgacgagcggatggagctcatccgcgaagtgaccagcgac
gtgcccaacctccgcgtcgactggtggggcggcctgctcgtcgactacaccaccgagcac
ggcatccatgcgctggtcaaggggctgcgcaccgcgctcgactacgagtacgagctaccg
atggcgcagatgaaccggcgactgaccggcatcgacaccttcttcctgctcaccgacgag
aaatacggctacatctcctcctcactgctcaaggaagtggccaagtacggcggggacgtg
cacggcctgctgcccgatgcggtcgtcgacgcggtcaaggagaagtaccgcacgatagac
gggtag
DBGET
integrated database retrieval system